PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID FANhyb_icon00004457_a.1.g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family EIL
Protein Properties Length: 138aa    MW: 16150.5 Da    PI: 5.4515
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
FANhyb_icon00004457_a.1.g00001.1genomekazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3152.65e-47241301116
                                       XXXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
                              EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgii 77 
                                       eelkkrmwkd+++l++ ke +k+    +e+ ++ +k    +e++rrkkm+raQD+iLkYM+k+mevc+a+GfvYgi+
  FANhyb_icon00004457_a.1.g00001.1  24 EELKKRMWKDRVRLEKYKEIRKS----EEP-VSLAK----EEASRRKKMARAQDSILKYMVKIMEVCEARGFVYGIV 91 
                                       8**************77777665....677.55544....8************************************ PP

                                       XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
                              EIN3  78 pekgkpvegasdsLraWWkekvefdrngpaaiskyqakn 116
                                       p+kgkpv+g+sdsLr+WWk++v+fd+n+p aisky ++ 
  FANhyb_icon00004457_a.1.g00001.1  92 PKKGKPVTGSSDSLREWWKDNVQFDQNAPLAISKYLPEV 130
                                       ***********************************6654 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048734.4E-4624130No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 138 aa     Download sequence    Send to blast
MVEIVEEVDH RSLEDEEAED ISYEELKKRM WKDRVRLEKY KEIRKSEEPV SLAKEEASRR  60
KKMARAQDSI LKYMVKIMEV CEARGFVYGI VPKKGKPVTG SSDSLREWWK DNVQFDQNAP  120
LAISKYLPEV LLECPSPS
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011457546.12e-87PREDICTED: putative ETHYLENE INSENSITIVE 3-like 4 protein
SwissprotQ9LX164e-50EIL4_ARATH; Putative ETHYLENE INSENSITIVE 3-like 4 protein
TrEMBLA0A0B2R6191e-53A0A0B2R619_GLYSO; ETHYLENE INSENSITIVE 3-like 5 protein
TrEMBLK7L6K08e-54K7L6K0_SOYBN; Uncharacterized protein
STRINGGLYMA08G14630.22e-53(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF32234200
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G10120.16e-45EIL family protein